PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.H30BW
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 421aa    MW: 46683 Da    PI: 8.1891
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.H30BWgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.12e-334397155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprl+Wtp+LH+rF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Araip.H30BW 43 KPRLKWTPDLHARFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 97
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.48940100IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-314198IPR009057Homeodomain-like
SuperFamilySSF466891.97E-164298IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-234398IPR006447Myb domain, plants
PfamPF002492.5E-94596IPR001005SANT/Myb domain
PfamPF143792.0E-24148194IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MYHHQGKNMH SSSRMPIPSE RHMFLQTGNG SGDSGLVLST DAKPRLKWTP DLHARFIEAV  60
NQLGGADKAT PKTVMKLMGI PGLTLYHLKS HLQKYRLSKN LHGQTNTVTH KITTNAGATT  120
SERSLSEPSG THMNKLSLGP QANNRDLHIS EALQMQIEVQ RRLNEQLEVQ RHLQLRIEAQ  180
GKYLQSVLEK AQETLGRQNL GMVGLEAAKV QLSELVSKVS SQCLNSAFSE LKELQGFCPQ  240
QPQTNQPNDC SIDSCLTSCE GSQKEQEIQN GGIGLRHLNG HGHAFMERKG GTEAPKWSNE  300
VKNNTFLAPL GKNSERSSYG AERSSGNLSM SIGLERETEN GSSMYTESHT HTDGEFWHRN  360
SNRTEPKNEA MDGGRGSHDY RLPPPYFSAA RLDLNSHGDN NEAATTTTSC KQLDLNRFSW  420
S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169975.10.0PREDICTED: uncharacterized protein LOC107612761 isoform X1
TrEMBLA0A0S3SH070.0A0A0S3SH07_PHAAN; Uncharacterized protein
STRINGGLYMA12G31020.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-139G2-like family protein